SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011085 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011085
Domain Number 1 Region: 94-205
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 2.35e-19
Family Leukotriene A4 hydrolase N-terminal domain 0.006
Further Details:      
 
Domain Number 2 Region: 215-480
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000000344
Family Leukotriene A4 hydrolase catalytic domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011085   Gene: ENSDORG00000011788   Transcript: ENSDORT00000011792
Sequence length 1150
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_409:943:55514:-1 gene:ENSDORG00000011788 transcript:ENSDORT00000011792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFVELTIFPTVANLNRIKKNSKQRIYRVINDLEAAFIYNXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKVLKIHINFSLDQPKGGLHFVVPSVEG
SMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHD
MRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVF
EFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQ
SLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELDKIVAYELK
TGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYTMFQCKAHLVMRLIENRISMEF
MLQVFNKLLSLASTASSQKFQSHMWSQMFASTSGFLKSISNVSGKDIQPLIKQWVDQSGV
VKFYGSFAFNRKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH
DIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQSDFM
WQYQLRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXCLRAIRVLQKNGHVPSDPALFKSYAEYGHFVDIRI
AALEAVVDYTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXTSHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPT
IIPESVTGNQEVTSNPSSHAQQIGFQNPFSSSQDEEEIDMDTVHDSQAFISHHLNMLERP
STPGLSKYRPASSRSSLMPQHSSGCDITPTTKPQWSMELARKGSGKEQSPLEMSMHSAVA
APLSVFAKESASSKHSDHHHHHHHEHKKKKKKHKHKHKHKHKTQTSESKDKDKQLASSSP
AYKCRSPSLD
Download sequence
Identical sequences ENSDORP00000011085 ENSDORP00000011085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]