SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011087 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011087
Domain Number 1 Region: 29-140
Classification Level Classification E-value
Superfamily PH domain-like 8.39e-40
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000735
Further Details:      
 
Domain Number 2 Region: 206-302
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 9.68e-35
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000627
Further Details:      
 
Domain Number 3 Region: 383-493
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.57e-23
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011087   Gene: ENSDORG00000011793   Transcript: ENSDORT00000011794
Sequence length 506
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3746:66567:132944:-1 gene:ENSDORG00000011793 transcript:ENSDORT00000011794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGQQPPPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKC
SGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNF
ANEEEAKKFRKAVTDLLGRRQRKSEKRREPPNGPNLPMATVDIKNPEITTNRFYGPQVNN
ISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGI
SEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPP
PPARGRGAPPPPPSRAPTAAPPPPPPSRPGVGVPPPPPNRMYPPPPPALPSSAPSGPPPP
PPPMTVSVSASVAPPPPPPPPPPPGPPPPPGLPPDGDHQVPSPAGNKAALLDQIREGAQL
KKVGQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRS
KAIHSSDEDDEEDDEEDFEDDDEWED
Download sequence
Identical sequences A0A1S3FHE4
ENSDORP00000011087 XP_012875469.1.60039 ENSDORP00000011087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]