SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011110 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011110
Domain Number 1 Region: 526-710
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 7.78e-56
Family Choline/Carnitine O-acyltransferase 0.00011
Further Details:      
 
Domain Number 2 Region: 270-435
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 6.67e-54
Family Choline/Carnitine O-acyltransferase 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011110   Gene: ENSDORG00000011817   Transcript: ENSDORT00000011818
Sequence length 718
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2786:3909:27123:-1 gene:ENSDORG00000011817 transcript:ENSDORT00000011818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPSSWLIVVVGVVSSTYTKVDPSLGLIARINRSLDTVATGRLSCQTKKVVSSVLFGTGLW
VALIITMRYSLKVLLSYHGWMFVEHGKLSRSTRIWMXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXTIQHLKDSKHVVVYHRGRYFRVSLYHSGRLLR
PRELEQQMQRILDDPSEPQPGEAKLAALTAGDRVPWAKCRQAYFRRGRNRQSLDAVEKAA
FFVTLDETEQGYRKEDPVASMRSYAKSLLHGKCYDRWFDKSITFITFKNGKMGMNAEHSW
ADAPIVAHMWEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMGKFCLTYEASMTR
LFREGRTETVRSCTMESCSFVLAMADPTQTVEQRLRLFKLASEKHQQLYRLAMTGAGIDR
HLFCLYVVSKYLAVDSPFLKEXXXEPWRLSTSQTPHQQVELFDLVNNPHYVSGGGGFGPV
ADDGYGVSYIIMGDNYIHFHISSKLSSPETDSHRFAKHLGEAMTDILNLFGLTPNSTK
Download sequence
Identical sequences ENSDORP00000011110 ENSDORP00000011110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]