SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011118 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011118
Domain Number 1 Region: 128-298
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.38e-33
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 447-586
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.81e-31
Family Ricin B-like 0.0014
Further Details:      
 
Domain Number 3 Region: 348-439
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.000000244
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011118   Gene: ENSDORG00000011826   Transcript: ENSDORT00000011827
Sequence length 601
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5505:10966:275901:1 gene:ENSDORG00000011826 transcript:ENSDORT00000011827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRKQKRFLQMTLLFMVALIFLPNIGLWSLYKDKHLVKSTEPGEQQTYPLGLGDGQFYSW
TDGLRRKDWHDYESIQKEAMRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPESLIAEIILVDD
FSDREHLKDKLEEYMARFSKVRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVN
WLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQR
ADPSDPFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVWMCGGEMFDVPC
SRVGHIYRKYVPYKVPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDISAQKE
LRKQLKCKDFKWFMAVVAWDVPKYYPPVEPPPAAWGEIRNVAANLCVDSKHGATGTELRL
DICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISHNSPVTLYDCHGMKGNQ
LWGYRKDRTLFHPVGNSCMDCNPAEKKIFMATCDPLSETQQWIFEHVNMTVIEKFSHHTS
S
Download sequence
Identical sequences ENSDORP00000011118 ENSDORP00000011118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]