SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011135 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011135
Domain Number 1 Region: 2-207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.63e-39
Family Laminin G-like module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011135   Gene: ENSDORG00000011841   Transcript: ENSDORT00000011845
Sequence length 1775
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_385:36242:172632:-1 gene:ENSDORG00000011841 transcript:ENSDORT00000011845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APVDVLKALDFHKSPEGITKTTGFCTNRKNSKGSDTAYRVSKLAQISAPTKQLFPAGNFP
EDFSILFTVKPKKGIQSFLLSIYNEHGIQQVGVEVGRSPVFLFEDHTGKPAPEDYPLFRT
VNIADGKWHRVAISVEKKTVTMIVDCKKKTTKPLDRSERSIVDTNGITVFGTRILDEEVF
EGDIQQFLISSDPKAAYDYCEHYSPDCDSTAPKAAQAQEPQIDEKKKSNFKKKTRTVTTY
SKETKKFTPPKSEKFASKKKKSYQAPAKAKLGVKANIVEDFQEYNYGTMESYQTETPVPV
SGTNEPYPVEEGFTEEYLTGEDYDPQRKNSEDTLYENKEIDGRDSDLPVDGDLGEYDFYD
YEDKPTSPSIEEFGPGVPAETDFTETSINGHGAYGEKGQKGEPAVVEPGMLVEGPPGPAG
PAGLMGPPGLQGPSGPPGDPGDRGPPGRPGLPGADGLPGPPGTMLMLPFRYGGDGSKGPT
ISAQEAQAQAILQQARIALRGPPGPMGLTGRPGPVGGPGSAGAKGESGDPGPQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXKGDRGFDGLPGLPGDKGHRGERGPQGPPGLPG
DDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGPTGQPGIAGIDGPPGPKGNMGPQGEPG
PPGQQGNPGPQGLPGPQGPIGPPGEKGPQGKPGLAGLPGADGPPGHPGKEGQSGEKGALG
PPGPQGPIGYPGPRGVKGADGVRGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQLGPRG
EDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKG
ARGVAGKPGPRGQRGPTGPRGSRGARGPTGKPGLKGTSGGDGPPGPPGERGPQGPQGPVG
FPGPKGPPGPPGKDGLPGHPGQRGETGFQGKTGPPGPGGVVGPQGPTGETGPIGERGHPG
PPGPPGEQGLPGAAGKEGAKGDPGPQGISKDGPALRGFPGERGLXXXXXXXXXXXXXXXX
XXXXXXGSPGERGSAGTAGPIGLPGRPGPQGPPGPAGEKGAPGEKGPQGPAGRDGVQGPV
GLPGPAGPAGSGEDGXXGEIGEPGQKGSKGDKGENXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLPGPPGEKGENGDVGPMGPPGPPGPRGPQG
PNGADGPQGPSGSVGSVGGVGQKGEPGEAGNPGPPGEAGSGGPKGERGEKGEAGPPGAAG
PPGAKGPPGDDGPKGNPGPVGFPGDPGPPGEPGPAGQDGVGGDKGEDGDPGQPXXXXXXX
XXXXXXXXXXXGPPGTTGAEGRQGEKGAKGEAGAEGPPGKTGPVGPQGPSGKPGPEGLRG
IPGPVGEQGLPGAAGQDGPPGPIGPPGLPGLKGDPGSKGEKRHPGLIGLIGPPGEQGEKG
DRGLPGTQGSPGAKGDGGIPGPAGPIGPPGPPGLPGPQGPKGNKGSSGPAGQKGDSGLPG
PPGPPGPPGEVIQPLPILSPKKTRRHTESVQADAVDNILDYSDGMEEIFGSLSSLKQDIE
HMKFPMGTQSNPARTCKDLQLSHPDFPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXVRISSWPKEKPGSWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFT
YNCHQSAAWYDASSGSYDKALRFLGSNDEEMSYENSPYIKALYDGCASRKGYEKTVIEIN
TPKIDQVPVIDVMINDFGDQNQKFGFEVGPVCFLG
Download sequence
Identical sequences ENSDORP00000011135 ENSDORP00000011135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]