SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011141 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011141
Domain Number 1 Region: 161-218
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000101
Family B-box zinc-binding domain 0.0000295
Further Details:      
 
Domain Number 2 Region: 499-572
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000435
Family SPRY domain 0.012
Further Details:      
 
Domain Number 3 Region: 367-415,457-502
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000675
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 4 Region: 3-82
Classification Level Classification E-value
Superfamily RING/U-box 0.00000173
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011141
Domain Number - Region: 108-158
Classification Level Classification E-value
Superfamily RING/U-box 0.003
Family ZZ domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011141   Gene: ENSDORG00000011851   Transcript: ENSDORT00000011851
Sequence length 572
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_710:4442:92344:1 gene:ENSDORG00000011851 transcript:ENSDORT00000011851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLPCAHSMCSCAHRILVSSCSSGESIEITAFQCTCRYVIS
LNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSESRRDRTYRPSSAMSSERIACQFCEQ
DPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHRLVEPVPDTHLRGITCLDHENEKVN
MYCVSDDQLICALCKLVGRHRDHQVASLNDRFEKLKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVNTAMHEAKLMEECDELVEIIQQRKQMIAVKIKETKVMKLRKLAQQVANRQC
LRSTVINAEHILKENDQARFLQSAKNIAERVAMATASSQVLIPDINFNDAFENFALDFSR
EKKLLEGLDYLTAPNPPSIREELCTASHDTITVHWISDDEFSISSYELQYTIFTGQANFI
SKSWCSWGLWPEIRKCKEAVSCSRLAGAPRGLYNSVDSWMIVPNIKQNHYTVHGLQSGTR
YIFIVKAINQSSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEKDESSLKKSHTP
ERFSGTGCYGAAGNIFIDSGCHYWEVVMGSST
Download sequence
Identical sequences ENSDORP00000011141 ENSDORP00000011141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]