SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011162 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011162
Domain Number 1 Region: 572-861
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-81
Family Protein kinases, catalytic subunit 0.0000000000505
Further Details:      
 
Domain Number 2 Region: 120-210
Classification Level Classification E-value
Superfamily Immunoglobulin 4.66e-23
Family I set domains 0.025
Further Details:      
 
Domain Number 3 Region: 29-127
Classification Level Classification E-value
Superfamily Immunoglobulin 3.63e-19
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 206-294
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000982
Family I set domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011162
Domain Number - Region: 371-454
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0497
Family Frizzled cysteine-rich domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011162   Gene: ENSDORG00000011874   Transcript: ENSDORT00000011873
Sequence length 874
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_196:23982:113115:1 gene:ENSDORG00000011874 transcript:ENSDORT00000011873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRELVHIPLVQILTLVAFSGTEKLPKAPVITTPLETVDALVEEVATFMCAVESYPQPEIS
WTRNKILIKLFDTRYSIRENGQLLTILSVEDSDDGIYCCIANNGVGGAAESCGALQVKMK
PKITRPPINLKIIEGLKAVLPCTTMGNPKPAVSWIKGDSTLRENSRIAILESGSLRIHNV
QKEDAGQYRCVAKNSLGTAYSKLVKLEIEVFARILRAPESHNVTFGSFVTLRCTATGIPV
PTISWIENGNAVSSGSIQESVKDRVIDSRLQLFITKPGLYTCIATNKHGEKFSTAKAAAT
ISIAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVSPFCRPAAEALLCNHVFQECIPGVVPTPSPICREYCLAVKELFCAKEWLLME
EKSHRGPPGSGTHLLSMLDCSKLPSMHWDPMACTRLPYLDYKKENLTTFPPMTSSKPSVD
IPNLPSSSSSSFPVSPTYSMTIIIAIMSSFAGFVLLIISTLYCCRRRKEWKNKKRESAAV
TLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARA
PGLLPYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLL
FEYMAYGDLNEFLRSMSPHTVCSLSHSDLSMRARVSSPGPPPLSCAEQLCIARQVAAGMA
YLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESI
FYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPLELYNL
MRLCWSKLADRPSFPSIHRILERMCERAEGAVGV
Download sequence
Identical sequences ENSDORP00000011162 ENSDORP00000011162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]