SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011174 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011174
Domain Number 1 Region: 219-339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.49e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 151-261
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000816
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011174
Domain Number - Region: 334-377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000904
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 45-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00135
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011174   Gene: ENSDORG00000011888   Transcript: ENSDORT00000011886
Sequence length 494
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1958:11003:78397:-1 gene:ENSDORG00000011888 transcript:ENSDORT00000011886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKVLFLTVLTVALVKSQDTEETITYTXXXXXXXXXXXXXXXXXIDECDIVPDACKGGMK
CVNHYGGYLCLPKTAQIIVNNEQPQQETPAGAEASSGATTGSVSASSVAASGVMPGGGFV
ASAAAVAGPEVQTGRNNFVIRRNPADPPRIPSNPSHRIQCAAGYEQSEHNLCQDIDECTA
GTHNCRADQVCINLRGSFTCQCPTGYQKRGEQCVDIDECTVPPYCHQRCVNTPGSFYCQC
NPGFQLAANNYTCVDINECDASNQCAQQCYNVLGSFICQCNQGYELSSDRISCEDIDECR
TSSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMCWNYHGGFRC
YPRNPCQDPYVLTSENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTVY
ANTINSFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREYIVNLEMLTVSSIGTFRTS
SVLRLTIIVGPFAF
Download sequence
Identical sequences ENSDORP00000011174 ENSDORP00000011174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]