SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011202 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011202
Domain Number 1 Region: 299-559
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.87e-86
Family Eukaryotic proteases 0.00000000406
Further Details:      
 
Domain Number 2 Region: 105-212
Classification Level Classification E-value
Superfamily Kringle-like 1.18e-32
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 3 Region: 213-302
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-31
Family Kringle modules 0.0000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011202   Gene: ENSDORG00000011916   Transcript: ENSDORT00000011917
Sequence length 561
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_529:46892:62796:-1 gene:ENSDORG00000011916 transcript:ENSDORT00000011917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLIRRELLCALLLCGAVLTLSSQEIHSRSRRGARSFRXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXCTQPRCFNAGTCWQALYFSDFVCQCPEGFVGKRCE
IDTRAICYKGQGINYRGTWSTAESGTECINWNSSALALKPYSGRRPGAIKLGLGNHNYCR
NPDRDSKPWCYVFKAGKYIAEFCSTPACSREVSEHCYTGRGLTYRGTHSRTTSGASCLPW
NSMILIGRSYTAWKSNSQALDLGKHNYCRNPDGDVKPWCYVLKDRKLTWEYCDLPQCSTC
GLRQYKQPQFRIAGGLFTDISSHPWQAAIFVKNKRSPGERFLCGGVLINSCWVLSAAHCF
LERFPYEHLTVVLGRTYRLVPGEEEQNFEVEKYIVHKKFDDDTYDNDIALLQLKCNSGQC
AQESSSVRPICLPDLQLPDWTECELSGYGKHEESSPFYSERLKEAHVRLYPSSRCTSQHL
FNRTVTGNMLCAGDTRSGGNQAVLHDACQGDSGGPLVCEKDKRMTLVGIISWGLGCGQKD
IPGIYTKVTHYLDWIQDNIEP
Download sequence
Identical sequences ENSDORP00000011202 ENSDORP00000011202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]