SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011209 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011209
Domain Number 1 Region: 51-119,153-209
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.66e-19
Family Ankyrin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011209   Gene: ENSDORG00000011924   Transcript: ENSDORT00000011924
Sequence length 308
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4178:13635:40394:-1 gene:ENSDORG00000011924 transcript:ENSDORT00000011924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTNFVLRSEHQNCCGSSTGPRRSVLCCASENAKAESFDSARYLQIQSFGKIHKAASQGD
VGKVQRKLLGGKNDVNARDKKNRTALHYACAYGHLAIALHRECEIDICDSHSTALXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYTNNVPIAAKLLAYNASIESQTKDGLTP
LLLALKENKQQMAEFLIENKANIHAVDELNSIKKTLSKYEENVLSSIPCNYSXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEETTEPAIGQNQNGS
TSENIDTS
Download sequence
Identical sequences ENSDORP00000011209 ENSDORP00000011209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]