SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011217 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011217
Domain Number 1 Region: 94-284
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.96e-37
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000239
Further Details:      
 
Domain Number 2 Region: 491-549
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000000000863
Family Ricin B-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011217   Gene: ENSDORG00000011932   Transcript: ENSDORT00000011932
Sequence length 554
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3592:5172:147495:1 gene:ENSDORG00000011932 transcript:ENSDORT00000011932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRFVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEM
GKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVV
IVFHNEAWSTLLRTVYSVINRSPHSLLSEVILVDDASERDFLKLTLENYVKNLEVPVKII
RMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVI
SDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXIMLKCHHMRNQLWDYDAERLTLRHVNSNQCLDESEEDKMVPTMQDCSGS
RSQQWLLRNMTLGA
Download sequence
Identical sequences ENSDORP00000011217 ENSDORP00000011217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]