SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011225 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011225
Domain Number 1 Region: 142-213
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Domain Number 2 Region: 202-261
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000486
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 3 Region: 91-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000021
Family EGF-type module 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011225
Domain Number - Region: 4-31
Classification Level Classification E-value
Superfamily EGF/Laminin 0.061
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011225   Gene: ENSDORG00000011940   Transcript: ENSDORT00000011941
Sequence length 718
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1510:29247:90548:-1 gene:ENSDORG00000011940 transcript:ENSDORT00000011941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDVCATCHEHATCQSKDGKKICICNYGFVGNGRTQCIXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDECVVSGVCGNGGRCVNTPGNFECYCVDG
YLPTNGPVPFHPSRDGTRCTEIDCGPALEIPGGFVIGNYTSRLGSQVHYGCKEGFFSVPE
YTVSSCTALGTWEAPQLHCQEINCGHPPEVQNAMLVGNHSSGLGGVAYYVCQEGFENTGG
EITSVCTEKGTWRESTLTCTETMTEISTVSVFNNTCVRQISLGRIDSKVVRVRHITGQWL
NPVKSVHEETIHLHTVRRTPEVCLNLHCASSTVSISTALPSHPGPTVLGLTAEGDLLEDD
GTFNVSVTNETCLKLNQQSKKVGSERIYQFKVLGQRWYLDSFYHATSFNLTTREHTPEVC
LPLFPATDYTVNITGLGPREHQVQITMTTAPTXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXPPLPEVEFFTVHGGSLPRLRLRKAKEENGPISSYQVVVLPLGLQSTFSCDSEGV
TSFFSNTSDADGYMAAELLAKDVTDDSLEVSIGDRLYYGNYYNAPLKIGNDYCIILRITS
EWNKXXXXXXXXXXXXXXIPWNCGFLRPHILTKLGGIAIRHSHRSRWWVLRWAPLLLW
Download sequence
Identical sequences ENSDORP00000011225 ENSDORP00000011225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]