SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011238 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011238
Domain Number 1 Region: 73-214
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.71e-49
Family Lectin leg-like 0.000000324
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011238
Domain Number - Region: 279-315
Classification Level Classification E-value
Superfamily HMG-box 0.00179
Family HMG-box 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011238   Gene: ENSDORG00000011955   Transcript: ENSDORT00000011955
Sequence length 497
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2896:35754:54967:-1 gene:ENSDORG00000011955 transcript:ENSDORT00000011955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSRRKRPQARSRPFFYALLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXAIPSSDQIRIAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGA
DGLAIWYTENQGLEGPVFGSADMWNGVGIFFDSFDNDGKKNNPAIVIVGNNGQIHYDHQN
DGASQALASCQRDFRNKPYPVRAKIIYYQKALTXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQEL
DKKKEEFQKGHPDLQGQPADDIFESVGDRELRQIFEGQNRIHLEIKQLNRQLDMILDEQR
RYVSSLTEEISKRGAGVPGQHGQISQQELDTVVKTQQEIMRQVNEMKNSMSETVRLVSGI
QHPGAAGVYESTQHFMDIKEHLHVVKRDIDSLAQRSLPSNEKPKCPELPPFPSCLSTVHF
VIFVVVQTVLFIGYIMY
Download sequence
Identical sequences ENSDORP00000011238 ENSDORP00000011238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]