SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011259 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011259
Domain Number 1 Region: 39-222
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.66e-52
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 417-483
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000684
Family SAM (sterile alpha motif) domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011259   Gene: ENSDORG00000011977   Transcript: ENSDORT00000011980
Sequence length 598
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1322:141803:157536:-1 gene:ENSDORG00000011977 transcript:ENSDORT00000011980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELSDEASEPELLNCSLSMWHGLGTQVSREELDVPLDLHTAASIGQYEVVKECVQRREL
DLNTKNGGGWTPLMYASYIGHDTIVHLLLEAGVSVNVPTPEGQTPLMLASSCGNESIAYF
LLQQGAELEMKDIQGWTALFHCTSAGHQQMVKFLLDSGANANVREPTYGFTPLMEAAAAG
HEIIVQYFLSHGVEVDTRDHSGATARMLARQYGHMKIVALIDTHSPARPKSLYRSPXXXX
XXXXXXXXYPVPQRHRPCRKGLSIHEGPRALARITAIGLGGKTPRPSYEQGPPRGYLTFT
GSDPLEGDGLCYRDVTSPINDHDVESSSSSSREEPGLCASVGAVQSSSSEGLGRARELSS
EASVESNEDSDHIQRSSARKQTKSYVKTKNRHGSSDGQWLPSPGGLPAGSASRTERPPYS
GPQDLAALLEQIGCLKYLQLFEEQDVDLRIFLTLTESDLKEIGITLFGPKRKMTSAIARW
HSSARPPSDALELAYADRLEAEMQELAIQLHKRCEEVEAMRGQVSQEQELRAVVESCLLE
QDGTRKDVHTQLEVTQALARDATLILDQLRACQAELSARVGQDPPARTAAPGPAAPPA
Download sequence
Identical sequences ENSDORP00000011259 ENSDORP00000011259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]