SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011285 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011285
Domain Number 1 Region: 45-193
Classification Level Classification E-value
Superfamily C-type lectin-like 1.61e-49
Family C-type lectin domain 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011285   Gene: ENSDORG00000012009   Transcript: ENSDORT00000012007
Sequence length 212
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_32808:4889:11743:1 gene:ENSDORG00000012009 transcript:ENSDORT00000012007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSKEVRLKPLGLQGGEGLLPSDEEELKSFGVRSSLGLGNFPESKQETIYQELTRMKAQ
VDHLCRPCPWDWISFQGHCYFLSNSQRNWHDSVTACQEVEAQLVSIESDEEQSFLQQTSK
KKGYTWMGLSDLNQEAAWVWVDGSPLSNRLKKYWNKGQPNNNGGQDCVEFRGEGWNDSNC
DNKKFWICKKSLSPCSHKWPVLTAQSSPLPQW
Download sequence
Identical sequences ENSDORP00000011285 ENSDORP00000011285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]