SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011304 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011304
Domain Number 1 Region: 242-393
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-24
Family C-type lectin domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011304   Gene: ENSDORG00000012027   Transcript: ENSDORT00000012026
Sequence length 397
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3758:59325:68873:-1 gene:ENSDORG00000012027 transcript:ENSDORT00000012026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVPEASPGVQAGANFPQEPKGSQVQGLEEPRVPAGEPQADGPGSHQEPAGAGQDLAED
KLPPPPRPGPLRAQPLSLGYGACREPPSPGPMSAEQPRDGEGPGAELLPGTWAPVELQVD
VRVKPVGAPGGSPSPAPSTRFLTVPVPESPAFSRHASPAHPLLQRAASPSAARGRASPLA
AAAPTERDRTGAESPATPAEEREASRGSRTCGCREPGLKEDLVAGAGMDGQELPRAIKLI
GLPMYIKSLRWSLVVLAVFLAVCTITIVVLASRAGAVCQPCPQGWMWSEERCYYLSAEAQ
DWKASQAFCMAHNATLPLFSHTQDLLSRYPVTKRSWVGAQRGPQGWHWIDGVPLLPQPLP
KEDLENPDLSCGGLEEGRLVALNCSSLRPWVCVQGKQ
Download sequence
Identical sequences ENSDORP00000011304 ENSDORP00000011304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]