SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011311 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011311
Domain Number 1 Region: 1635-1821
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.9e-35
Family Laminin G-like module 0.00035
Further Details:      
 
Domain Number 2 Region: 1466-1633
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-31
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 1049-1230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-22
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 4 Region: 1224-1372
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1e-18
Family Laminin G-like module 0.022
Further Details:      
 
Domain Number 5 Region: 154-173,836-1019
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000123
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 6 Region: 82-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000181
Family Laminin-type module 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011311
Domain Number - Region: 340-576
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00314
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011311   Gene: ENSDORG00000012032   Transcript: ENSDORT00000012033
Sequence length 1822
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1833:130570:284632:-1 gene:ENSDORG00000012032 transcript:ENSDORT00000012033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSAAWWCSVLPLWLLWGAAYSSAASGDSPFAFDVEGSSPVGRQDLPETGEPHVTSRRP
PPVVQRCNTGFFRASSGDCLPCDCNDNSNECLDGSGLCVHCQRNTTGDHCEKCLDGYIGD
SIRGVPRFCQACPCPLPHLANFAESCYRKNGAVRCICKENYAGPNCERCAPGYYGNSLLI
GSTCRKCDCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
CNCGGGPCDSVTGECLEEGFELPTGTDCPTISCDKCIWDLTDDLRLAALSIEESKSGLLS
VSSGAAAHRHVNEMNSTISLLKTKLSERENQYTLRKIQINNAENTMKSLLSDLEELTRKG
NQASRKGQLVQKESMDTIDHATQLVEQAHNMRDKIQEINNKMLYYEEEQELGPEEVAEKL
VLARKMVEEIRSYPSFLTQRELVDEEADEAQDLLSHVENWQRLHNDTRSLFPVILEQLDD
YRAKLSDLQESLDQALDHVRDAEDMNRAIASRQRDHEKQHERVQEKVELVNMSLSASAES
LSTPRLTLVELDDIIKNASGIYAEIDGAKNELQRTLSNLSNLNHDLVQEAIDHARNLQEE
ADELSRRLHSSDMNGLVQKALDASNVYENIASYVDEASEKAEFALNITERIYDAVSGIDT
QIIYHRDESDNLLNQARELQDQADISNEAAVADTSRRVSGALSRKDVLKNILNDAVKRLQ
AAERGDAQLRLGQSKLVIQEANKAMMEVQRVTGPMAGNLTDWSQNLQSFDSSVYTAVXXX
XXXXRNLSEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVANKIQVSMMFDGQ
SAVEVHPKTRMDDLKAFTSLSLYMKPPVRQPDVAEIADQFVLYLGSKSAKRQYMGLAIKN
DNLVYVYNLGAKDVEIPLDSKPVSSWPAYFSIVKIERIGKHGKVFLTVPSLSSTAEEKFI
KKGTFAGNNSLLDLSPEDTVFYVGGVPSNFKLPPSLNLPGMCAGCLELATLNNDVISLXX
XXXXXXXXXXXXXXXXXNKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFDIEVR
TPADHGLVLLMVNGSMFFSLEMHNGYLHVFYDFGFSNGPVHLEDTLKKAQINDAKYHEIS
IIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILHSRTLRAHLLLDINFRG
CMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFISSAQKISFFDGFEGG
FSFRTLQPNGLLFYYASGSDVFSISLDNGTVIMDVKGIKVQLAEKQLNDGLAHFIITSIS
PTRYELIVDQNRLVNKNLTFGKAQEPPAGEKKFYFGGSPISPQYANFTGCSNAYFARLDR
DVEVEDFQQYSEKVHTSLYECPMETSPLFLLHKKEKNSSKPKASQNKKGEKSKDAPSWDP
VGLKFLEQNAPKDSHCHLSNRPRAIEHAYQYGGTANSRQEFEHLKGDFGEKAQFSIRLKT
RSSHGMIFYVSDQEENDFMTLFLAHGRLVFMFNVGHKKLKIRSQEKYNDGLWHDVIFVQE
KSSGRLVIDGLRVLEESLPPTRAAWKIKGPIYLGGVAPGRAVKNVQINSVYSFSGCLCNL
QLNGASITSASQTFSVTPCFEGPMETGTYFATEGGYVVLDESFNIGLKFEIAFEVRPRSS
SGTLVHGHSVNGEYLNIHMKNGQVIVKVNNGVRDFSTSVTPKQSLCDGRWHRITVIRDSN
VVQLDVDSEVNHVVGPLNPKSADHREPVFVGGVPESLLTPHLTPDKPFTGCIRHFVIDGR
PVSFSKAALVSGAVSINSCPAA
Download sequence
Identical sequences ENSDORP00000011311 ENSDORP00000011311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]