SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011332 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011332
Domain Number 1 Region: 521-872
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.67e-99
Family Hect, E3 ligase catalytic domain 0.000000207
Further Details:      
 
Domain Number 2 Region: 6-108,142-226
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.29e-39
Family Ankyrin repeat 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011332   Gene: ENSDORG00000012054   Transcript: ENSDORT00000012055
Sequence length 879
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_794:4297:66430:-1 gene:ENSDORG00000012054 transcript:ENSDORT00000012055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NETAVYTLMPMVMADQHRSVSELLSNSKFDVNYAFGRVKRSLLHIAANCGSVECLVLLLK
KGADPNYQDISGCTPLHLAARNGQKKCMSKLLEYSADVNICNNEGLTAXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVQCLLDSGADINRPNVSGATPLYFACS
HGQRDTAQILLLRGAKYLPDKNGVTPLDLCVQGGYGETCEVLIQYHPRLFQTIIQMTQNE
ELRENMLRQVLEHLSQQSENQYLKILTSLAEVATTNGHKLLSLSSNYDAQMKSLLRIVRI
FCHVFRIGPSSPSNGIDMGYNGNKTPRSQVFKPLELLWHSLDEWLVLIATELMKNKKNSA
DITSILLKQKGHDQGATSIPPFEPPEPKSYENLSTGPGESKPDAVAVKQEANADCQDVIS
MTANRLSAVIQAFYMCCSCQMPPGMTSPRFIEFVCKHDEVLKCFVNRNPKIIFDHFHFLL
ECPELMSRFMHIIKAQPFKDRCEWFYEHLHLGQPDSDMVHRPVNENDILLIHRDSIFRSS
CEVVSKANCAKLKQGIAVRFHGEEGMGQGVVREWFDILSNEIVNPDYALFTQSADGTTFQ
PNSNSYVNPDHLNYFRFAGQILGLALNHRQLVNIYFTRSFYKHILGIPVNYQDVASIDPY
AKNLQWILDNDISDLGLELTFSVETDVFGAMEEVPLKPGGGSILVTQNNKAEYVQLVTEL
RMTRAQQINAFQGFHMFIPPSLIQLFDEYELELLLSGMPEIDVSDWIKNTEYTSGYERED
PVIQWFWEVVEDITQEERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAXXXXXXXXX
XXXXXXINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA
Download sequence
Identical sequences ENSDORP00000011332 ENSDORP00000011332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]