SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011342 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011342
Domain Number 1 Region: 68-257
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.11e-52
Family Astacin 0.00016
Further Details:      
 
Domain Number 2 Region: 425-587
Classification Level Classification E-value
Superfamily TRAF domain-like 1.05e-33
Family MATH domain 0.0013
Further Details:      
 
Domain Number 3 Region: 606-647
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000995
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011342
Domain Number - Region: 385-428
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000301
Family MAM domain 0.02
Further Details:      
 
Domain Number - Region: 264-301
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000665
Family MAM domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011342   Gene: ENSDORG00000012065   Transcript: ENSDORT00000012065
Sequence length 702
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1210:83335:111110:1 gene:ENSDORG00000012065 transcript:ENSDORT00000012065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWWCLPGFLVFGTCLLVSGLVLLEMCKDVDEGIDRDIFDINEDLGLDLFDGDINLAGTQ
DRNSIIGEEYRWPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGEPNYISVI
KSSGCWSSVGNRRVGKQDLSIGANCDRIATVQHEFLHALGFWHEQSRSDRDDYVSIIWDR
ILEGREHNFNIYDDKVSDSLNVPYDYTSVMHYSKTAFRNGTEPTIVTRISDFEDVIGQRM
DFSDYDLLKLNRLYNCSSSLTFMDSCNFELENVCGMVQSSRDSADWQWVSQVSSGPENDH
SNMGQCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXIPVGSWQLYYVTLQVTNKFRVVFEGLRGSGASSGGLSIDD
INLSETRCPHHIWHIRNFTQLVESQNGTLYSPPFYSPKGYAFQIYLDLKSVTDVGIYFHL
ISGANDDQLQWPCPWQQATMTLLDQNPDIRQRMSNQRSVTTDPFMTTGNGNYFWDRPSKV
GAVVSFPNGTQFHRGPSYGTSVFLSRKRMQSRDFIKGNDVFILLTVEDIAHLNTSQVQPI
PTSDILDLCSSVTCENGGICTVKNGKAECRCPAGEDWWFMGERCERKGSTRDTIIIAASS
TAAVFGLMLIVTLISVYCTRKKYRPKTSSNTENINLENQYAF
Download sequence
Identical sequences ENSDORP00000011342 ENSDORP00000011342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]