SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011344 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011344
Domain Number 1 Region: 4-46
Classification Level Classification E-value
Superfamily UBA-like 0.00000000187
Family TAP-C domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011344   Gene: ENSDORG00000012068   Transcript: ENSDORT00000012067
Sequence length 258
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4086:22038:50972:-1 gene:ENSDORG00000012068 transcript:ENSDORT00000012067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRLKSSQKDKVRQFMACTQAGERTAIYCLTQNDWKLDEATDSFFQNPDSLLQESMRNTVD
QKKLEQLYGRYKDPQDENKIGIDGIQQFCDDLNLDPASISVLVIAWKFRAATQCEFSKKE
FVDGMTELGCDSTEKLRALLPRLEQELKDSAKFKDFYQFTFTFAKNPGQKGLDLEMAVAY
WKLVLSGRFKFLDLWNTFLLEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLID
DFVEYARPVVTGGKRRPF
Download sequence
Identical sequences ENSDORP00000011344 ENSDORP00000011344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]