SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011353 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011353
Domain Number 1 Region: 41-139
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.4e-45
Family Ankyrin repeat 0.00000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011353   Gene: ENSDORG00000012076   Transcript: ENSDORT00000012076
Sequence length 139
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1017:210213:213335:-1 gene:ENSDORG00000012076 transcript:ENSDORT00000012076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAEDKGVLGGGGGSDAGLAGAAARGQVEKVRQLLEAGADPNRVNCYGRRPIQVMMMGNT
RVAELLLLHGAEANCADPTTLTRPVHDAAREGFLDTLVMLHRAGARLDVRDAWGRLPVDL
AEERGHWEVARYLRAAAGD
Download sequence
Identical sequences A0A1S3FIQ8
ENSDORP00000011353 XP_012876200.1.60039 ENSDORP00000011353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]