SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011367 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011367
Domain Number 1 Region: 234-260,289-450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-37
Family Laminin G-like module 0.0000000799
Further Details:      
 
Domain Number 2 Region: 466-672
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-34
Family Laminin G-like module 0.000000028
Further Details:      
 
Domain Number 3 Region: 117-235
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000487
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 47-84
Classification Level Classification E-value
Superfamily GLA-domain 0.0000000000404
Family GLA-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011367   Gene: ENSDORG00000012090   Transcript: ENSDORT00000012090
Sequence length 677
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5904:11771:40669:1 gene:ENSDORG00000012090 transcript:ENSDORT00000012090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPAGAAARRRAPLLLLLLLASASAHXXXLRARESAQFLRSVPCHAYQVFEEVMQGHLE
RECVEELCSREVVWEVFENNLVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPDQCTP
NPCDEEGTEVCQDLMGNFFCKCRSGWEGRLCDRDIDECGQENGGCSQACHNKPGSFYCTC
HSGFALAPDGRTCQDIDECAESDACGEARCKNLPGSYSCLCDKGYAYSAQEKACQDVDEC
QQGRCEQTCVNSPGSYTCHCDGRGGLKLSPDMDTCEWQDILPCVPFSMAKSMKSFVLGRM
FSATPVIRLRFKRLQPTRLVAEFDFRTFDPEGILLFAGGHLDSNWVVLGLRAGRLELQLR
YNGVSRITSSGPVINHGMWQTISVEELERNLVIKVNKDAVMKIAVAGELFQQDRGLYHLN
LTVGGVPFKEKDLIQPMNPRLDGCMRSWNWLNGEDNTIQETVKANTKMQCFSVTEKGSFF
PGNGFAFYSLGYTRTSSDVGTETTWGIEVVARIRPATDTGVLLALVADDHAVPLSVALVD
YHSTKKLKKQLVVLAVEDVALALMEIKVCDGQEHVVTVSLRANEATLEVDGTKGQSEVTA
SQLQERLAILETHLQGSVLTFVGGLPGVPVTSAPVIAFYRGCMTLEVNQKLLDLDEAAYK
HSDITSHSCPPVEHSTP
Download sequence
Identical sequences ENSDORP00000011367 ENSDORP00000011367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]