SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011424 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011424
Domain Number 1 Region: 347-531
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.37e-39
Family Hemopexin-like domain 0.0006
Further Details:      
 
Domain Number 2 Region: 166-323
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.31e-37
Family Matrix metalloproteases, catalytic domain 0.00018
Further Details:      
 
Domain Number 3 Region: 42-121
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000000612
Family MMP N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011424   Gene: ENSDORG00000012150   Transcript: ENSDORT00000012149
Sequence length 564
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5535:94836:100960:-1 gene:ENSDORG00000012150 transcript:ENSDORT00000012149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAARDLPATLLLCWLAAPRPAQAQNLFHSRDRSDLAPSPRQRAKPIADLRAAQRFLSRYG
WSKGSSARGPSPKGPPPAPSGSALAEAMLRFQKANALPASGKLDAATLAAMNRPRCGVPD
TRPPPQAAGKTPPAPRARPKRFLQALLPRPGRQREDSLDSGAIWAFSKKTLTWRLVGEAY
SSQLSVDEQRYIFRLAFRMWSEVTPLDFREDLTAPGTTVDIKLGFGRGRHMGCPRVFDGS
GQEFAHAWRLGDIHFDDDEHFTPPTSDMGISLLKVAVHEIGHVLGLPHTHRTGSIMQPNY
TPQGPAFELDWSDRKAIQKLYGSCEGSFDIAFDWIRKERNQYGEVRVRFSTYFFRKSWYW
LYENRNNRTRFGDPLQILTGWRGIPALNLDAFVHVWTWRRDERYFFKGNQYWRYDSDRDQ
AYTEDEQGRSYPKLISEGFPGIPSPLDTAFYDRRQQLIYFFKESSVFAFDVNRNQVLDSY
PMQITQVFPAVAPQNHPFRNIDSAYYSYAHNSVFFFKGNAYWRVVNDKDQQHNTSLPLNG
LLPKRPTSGKWFDVCDVDASTLNM
Download sequence
Identical sequences ENSDORP00000011424 ENSDORP00000011424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]