SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011489 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011489
Domain Number 1 Region: 2-127,170-231
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.82e-52
Family Eukaryotic proteases 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011489   Gene: ENSDORG00000012218   Transcript: ENSDORT00000012220
Sequence length 278
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5913:7102:14240:1 gene:ENSDORG00000012218 transcript:ENSDORT00000012220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWPWQASLLYHGSHICGAALIDRYWVTSAAHCFQRSQRPSDYRILLGYNQLSNPTNYSLK
KTVYKLIVHPDYDKFHRQGSDIVLMQMHTPVEFNSHVFPACVATTKLLQDRPCWISGWGM
ITEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXGDSGGPLVCPLNGSWYLVGLSSWSVACSSDSPSVFTRVSYFFDWIEKNKRVPEPGII
PPKDDGPALAGMASHGLALKPSICLVLLSAPLLLRSLR
Download sequence
Identical sequences ENSDORP00000011489 ENSDORP00000011489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]