SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011493 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011493
Domain Number 1 Region: 61-180,256-361
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 9.42e-64
Family FabD-like 0.0000896
Further Details:      
 
Domain Number 2 Region: 189-263
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000017
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011493   Gene: ENSDORG00000012225   Transcript: ENSDORT00000012224
Sequence length 383
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_9568:30488:36164:1 gene:ENSDORG00000012225 transcript:ENSDORT00000012224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGARVARGVWALSRAAGGCRAASSFQAPPPGAVDVAELLREAAGGEARAKAARRPPDRCS
VLLFPGQGSQAVGMGRGLLGYPRVRELYAAASRVLGYDLLELSLHGPQEDLDRTVHCQPA
VFVASLAAVEKLHHLKPQVIENCVAAAGFSVGEFAALVFAGAMEFSEGLYAVKVRAEAMQ
EASEAVPSGMLSVLGQPQSKFAFACLEAREHCKSLGIEDPVCEVSNFLFPDCRVISGHLE
ALQFLRKNSSKYHFRRTKMLPVSGAFHTRLMEPAVEPLARVLKTIDVKKPLVAVYSNVSG
NRYTHPTHIRKLLGEQVVSPVKWEQTMHAVYQREKGAAFPSTFEVGPGTQLGSILRSCNM
QAWKSYSHVDVMEGSQDPEPAPP
Download sequence
Identical sequences ENSDORP00000011493 ENSDORP00000011493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]