SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011525 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011525
Domain Number 1 Region: 622-797
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.55e-45
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000848
Further Details:      
 
Domain Number 2 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 6.8e-37
Family Second domain of FERM 0.000075
Further Details:      
 
Domain Number 3 Region: 215-360
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-25
Family Third domain of FERM 0.0011
Further Details:      
 
Domain Number 4 Region: 29-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-22
Family First domain of FERM 0.001
Further Details:      
 
Domain Number 5 Region: 557-603
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000597
Family PDZ domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011525   Gene: ENSDORG00000012255   Transcript: ENSDORT00000012258
Sequence length 922
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_848:3855:75337:1 gene:ENSDORG00000012255 transcript:ENSDORT00000012258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFRVNKHDQGQVLLDIVFK
HLDLTERDYFGLQLADDSTDNPKWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPYNTAALLASYAIQSELGDYNQSENLPGYLSEYSFIPNQ
PQDFEKEVAKLHQQHIGSSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGG
ILIYKNRVRMTFPXXXXXXXXXXXXXXXXXXXXXXHESRETLLGFNMVNYRACKNLWKAC
VEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPSK
PLARKLMDWEVVSRNSVSDDRLETQSLPSRSPPGTPNHRNSVFTQEGNRVRPSSVGHLVD
HVVHPSASEIFVNERSPSSTQANSIVLESSPSQETPEDGQPPALPPKQSKKNSWNQIYYS
HSQQDLENHTSETFDVPSSPEKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELVLLV
RPNAVYDVVEEKLENEPDFQYIPEKAPLDSIHQDDHSLRESMIQLAEGLITGTVLTQFDQ
LYRKKPGMTMCCAKLPQNISKNRYRDISPYDATRVILKGSEDYINANYINMEIPSSSIIQ
YIACQGPPHTCTDFWMTWEQGSSMVVMLTTQVERGRVKCHQYWPDAIGSSSYGCYQVTCH
SEEGNPAYIFRKMTLFNQEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQYRFV
CEAILKVYEEGFVKPLTTTSNK
Download sequence
Identical sequences ENSDORP00000011525 ENSDORP00000011525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]