SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Dipodomys ordii 76_1 > ENSDORP00000011583

Domain assignment for ENSDORP00000011583 from Dipodomys ordii 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSDORP00000011583
Domain Number 1	Region: 53-90
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000000106
Family	LDL receptor-like module	0.00067
Further Details:

Domain Number 2	Region: 124-166
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000288
Family	LDL receptor-like module	0.0012
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSDORP00000011583 Gene: ENSDORG00000012323 Transcript: ENSDORT00000012322
Sequence length	267
Comment	pep:known_by_projection scaffold:dipOrd1:scaffold_5078:25347:30828:-1 gene:ENSDORG00000012323 transcript:ENSDORT00000012322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	AASGWMARGGERRTVALGLVLRLLLGFGLGLEAAPTSVRTQTPIQAPGLGSGSCPSTSFQ CGTNGYCVPLTWRCDGDRDCADGSDEEECRIEPCAQDGHCPPPSALPCSCDNLSGCPGGI RAPHNCSQGLCREDERRCAATEACVPHTWLCDGHPDCPDASDELGCETSLDTNETFQEGS TTPVATPVTLESITSLQNTTATLTGNQAGSPSAYRVVVAAGVLSAILVAATLLLLFRLRA RGRLPPMRLLVAVKESLLLSERKTSQL
Download sequence
Identical sequences	ENSDORP00000011583 ENSDORP00000011583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]