SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011606 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011606
Domain Number 1 Region: 158-253
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-29
Family C-type lectin domain 0.0000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011606   Gene: ENSDORG00000012345   Transcript: ENSDORT00000012345
Sequence length 254
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4483:135:8916:-1 gene:ENSDORG00000012345 transcript:ENSDORT00000012345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKDFQNIQQLDLEESNNQFSGGEEPGTHGQNPRRESPFWKXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXHATLFLHLKHFPTDMSSLECNMVFLQSNGTKCCPVNWV
KYGGSCYWFSRAGMNWHEAYAYCQLENAHLVVINSWDEQRFIVEHMSPFHTWIGLSDIQG
PWKWVDGTNYEHNY
Download sequence
Identical sequences ENSDORP00000011606 ENSDORP00000011606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]