SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011612 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011612
Domain Number 1 Region: 123-274
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.99e-40
Family Dual specificity phosphatase-like 0.0000681
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011612   Gene: ENSDORG00000012352   Transcript: ENSDORT00000012352
Sequence length 281
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_697:9204:20602:-1 gene:ENSDORG00000012352 transcript:ENSDORT00000012352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGLCHSAALGLALLMLLEALAPVDAQKTVRAWHGAHSGAHYSIHFLCPSTPPSHCLQSAQ
KQHQECRHRRLDAGSPDCSSEKTTAWARYHHRMESLQKSKIRGTLYQPPTLASLQRLLWV
RRPSTLNHINEVWPNLFLGDAYAARDKNRLVQLGITHVVNVAAGKFQVDTGAKFYRGLPL
EYYGIEADDNPFFDLSVYFLPAAQHIRAALSSPRGRVLVHCAMGVSRSATIVLAFLMICE
NMTLVEAIQTVQAHRDICPNSGFLRQLQVLDNRLGRGTGRL
Download sequence
Identical sequences ENSDORP00000011612 ENSDORP00000011612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]