SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011624 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011624
Domain Number 1 Region: 1572-1686
Classification Level Classification E-value
Superfamily C-type lectin-like 4.47e-40
Family Noncollagenous (NC1) domain of collagen IV 0.00000569
Further Details:      
 
Domain Number 2 Region: 1467-1571
Classification Level Classification E-value
Superfamily C-type lectin-like 8.71e-35
Family Noncollagenous (NC1) domain of collagen IV 0.00000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011624   Gene: ENSDORG00000012362   Transcript: ENSDORT00000012364
Sequence length 1688
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5149:185112:288042:-1 gene:ENSDORG00000012362 transcript:ENSDORT00000012364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSPGHLVIMKLFLRWTKPLLTDSWSLVLILFSVQHTCGTGKKYVGPCGGRDCSVCLCFPE
KGSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPTGIPGFPGL
GGIPGHPGPPGSRGKPGLNGYNGSRGDPGFPGERGVPGPGGPPGLPGERGEKGNSVFIAG
AIKGTQGDPGDPGPLGLPGSRGPPGPVGPRGYPGAAGLTXXXXXXXXXXXXXXXXXXXXX
XXXXXGEVGQQGSPGPTLLIEPPDASLYKGEKGIKGLPGMIGLPGPPGPKGESGIGIKGE
KGLPGFPGPRXXXXXXXXXXXXXXXGEQGQVGEPGLFGLRGPKGDLGERGHPGPPGILVT
PPVPLKGPTGDPGFPGRQGEMGAIGPLGPPGPPGLPGVACPGIPGPPGPPGFPGPPGLPG
EAGVPGKPDLAPGKPGHPGPPGLPGAPGQPGPPGSDVIQCGSYPGPPGIKGXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
GKPGALGPPGFKGTKGDMVVARVKGIKGERGPDGPPGFPGQRGQHGQDGRGGETGEPGPP
XXHEDAIPGAKGFPGPPGPPGKPGPMGPPGLGYPGPPGERGKPGLPGRPGVRGPDGAKGQ
KGDTILCNVTYLGKPGPPGFDGPPGLKGFPGPPGAPGQRCLDGQKGQRGKPGASKIPGPP
GLRGNMGDPGFEGEKGSSPPGPPGPPGRRGVDGQKGIPGESAFGHPGPPGNRGLPGVPGM
KGARGHPGCPGAEGAAGVPGSPGLKGSRGREGSLGFPGIPGPPGQSCSKGSAGIPGQPGL
PGAPGSPGAPGWKGQRGEAGPSGPAGMKGFPGPPGLPGADGFLGPPGIPGPLGEDGLPGL
PGPKGPRGLPGFPGFPGERGLPGREGLPGRKGEIGQKGWPGFGGDQGVRGAKGTRGPPGA
AGEMAIFLKKGKAGEPGPPGENGFPGARGDKGSAGLPGRRGEPGQHGPPGLHRGEPGRNG
EPGFPGPPGPPGLPGLRGVIGFPGLPGDQGEQGFPGPRGFSGNDGGRGPKGIKGDPASLY
GLPGPKGKPGSLGCPGHVGAPGERGLPGDQGPRGPPGRPGPPGSMGPPGCPGEQGLPGLE
GQPGDVGDLGPRGLPGNPGIPGPPGVKGPAGSPGLNGLHGLKGEKGSKGASGLYEMGPPG
PMGLPGIKGERGDPGSPGISPPGPIGEKGFPGPPGPPGPPGPAGAPGRAPEGDIPEQGPP
GDQGLPGPDGPRGEPGPPGPPGSVDLLKGDPGDYGLPGAPGSPGPPGPPGCQGIPGCDGK
DGQKGPMGFPGPPGPPGFPGPPGEKGLPGPPGRKGPLGPPGSRGEPGPPADADACPRIPG
LPGVPGPRGPEGAVGLPGQRGPPGPGCKGKPGLDGRRGQDGVPGPPGPPGHKGEAGETGC
AGKPGPPGLTGDPGPKGTGLGYLSGFLLVLHSQTDQEPACPVGMPRLWTGYSLLYMEGQE
KAHNQDLGLAGSCPMFSTLPFYCNIHQVCHYARRNDRSYWLASAAPLHMMPVSEEEIRPY
ISRCAVCEAPAQAVAVHSQDQSIPPCPRAWRSLWIGYSFLMHTGAGDQGGGQALTSPGSC
LEDFRAAPFLECQGRQGTCHFFANEYSFWLTTVNPETQFTLAPSPDTLKEGQAQRQKISR
CQVCVKYS
Download sequence
Identical sequences ENSDORP00000011624 ENSDORP00000011624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]