SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011636 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011636
Domain Number 1 Region: 40-289
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.06e-62
Family Leukotriene A4 hydrolase catalytic domain 0.00000464
Further Details:      
 
Domain Number 2 Region: 298-442
Classification Level Classification E-value
Superfamily ARM repeat 6.33e-34
Family Leukotriene A4 hydrolase C-terminal domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011636
Domain Number - Region: 12-34
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 0.00105
Family Leukotriene A4 hydrolase N-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011636   Gene: ENSDORG00000012376   Transcript: ENSDORT00000012376
Sequence length 474
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3608:43705:48840:1 gene:ENSDORG00000012376 transcript:ENSDORT00000012376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATRSTYVEEEGVYHFHMEHPVPAYLVALVAGDLKPADIGPRSRVWAEPCLLPTATSKL
SGVVEQWLSAAERLYGPYMWGRYDIVFLPPSFPIVAMENPCLTFIISSILESDEFLVIDV
IHEVAHSWFGNAVTNATWEEMWLSEGLATYAQRRITTETYGAAFTCLETAFRLDALHRQM
RLLGEDSPVSKLQVKLEPGVNPSHLMNLFTYEKGYCFVYYLSQLCGDPQRFDDFLRAYVE
KYKFTSVVAQDLLDSFLSFFPELKEQSVDCRAGLEFERWLNATGPPLAEPDLSQGSSLTR
PVEALFQLWTAGPLDQAAASASAADISKWRTFQTALFLDRLLDGCPLPQEVVTSLSKCYS
SLLDSMNAEIRIRWLQIVVRNDYYPDLHRVRRFLESQVSRMYTVPLYEDLCTGALKSFAL
EVFYQTHGRLLPNLRRTIQQILSQGLGPSTEATSALLLEGCPGGTIFFQNVNVS
Download sequence
Identical sequences ENSDORP00000011636 ENSDORP00000011636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]