SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011651 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011651
Domain Number 1 Region: 144-271
Classification Level Classification E-value
Superfamily ApaG-like 2.22e-28
Family ApaG-like 0.00099
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000863
Family SMI1/KNR4-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011651   Gene: ENSDORG00000019770   Transcript: ENSDORT00000012392
Sequence length 274
Comment pep:novel scaffold:dipOrd1:scaffold_7329:55262:56128:-1 gene:ENSDORG00000019770 transcript:ENSDORT00000012392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLSEEELDAIEAQIGCRLPDDYRCSFRIHNGQKLVVPGLFGTIQLLDHQRSEDFLDAMLA
AGGFQPKRGLKYCLPLTFCVHTGLIQYLAVEAAEGRNKNEVFYHRSSSFTDWFTSYVNDV
VSGRFLVTRNQILRYMQDPDCVATTGDITVSVSTSFLPELSSINPPQYFFSYQIKVEMSR
DALPDEVCQLYSCCLKVTNSNGDVEVIRGPGVEDELPTLTPGQKYEYFGCTIFSTISGYI
EGYYTFYLQRFKERIYNVAIPRFYLECPKSVVFR
Download sequence
Identical sequences ENSDORP00000011651 ENSDORP00000015860 ENSDORP00000011651 ENSDORP00000015860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]