SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011670 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011670
Domain Number 1 Region: 313-530
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.31e-25
Family Clostridium neurotoxins, the second last domain 0.034
Further Details:      
 
Domain Number 2 Region: 121-227
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-16
Family Cadherin 0.0042
Further Details:      
 
Domain Number 3 Region: 9-133
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000614
Family Cadherin 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011670   Gene: ENSDORG00000012409   Transcript: ENSDORT00000012411
Sequence length 908
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5331:32407:60125:-1 gene:ENSDORG00000012409 transcript:ENSDORT00000012411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKHKPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEICGFKIHG
QNVPFDAVVVDKSTGEGIIRSKEKLDCELQKDYTFTIQAYDCGKGPDGTGVKKSHKATVH
IQVNDVNEYAPVFKEKSYKATVVEGKQYGSILRVEAVDADCSPQFSQICSYEIITPDVPF
TVDKDGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRATEDVLVKISIKPTCTPGWQGWSNR
IEYEPGTGALAVFPNIHLETCDEPVASVQATVELETSHIGKGCDRDTYSEKSLHRLCGAA
AGTAELLPSPSSSLNWTIGLPTDNGHDSDQVFEFNGTQAVRIPDGIVSLNPKEPFTISVW
MRHGPFGRKKETILCSSDKTDMNRHHYSLYVHGCRLIFLLRQDPSEEKKYKPAEFHWKLN
QVCDEEWHHFVLNVEFPSVTLYVDGVSHEPFSVTEDYPLHPTKIETQLVVGACWQXXXXX
XXXXXXXXXXXXXXXGDLHMTQFFRGNLAGLTVRSGKLADKKVIDCLYTCKEGLDLQVPD
DGGQGVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVN
VIHTANPMEHANHMAAQPQFVHPEHRSFVDLSGHNLANPHPFAVVPSTATVVIVVCVSFL
VFMIILGVFRIRAAHQRTMRDQDTGKENEMDWDDSALTITVNPMETYEDQHSSEEEEEEE
EEEESEDG
Download sequence
Identical sequences ENSDORP00000011670 ENSDORP00000011670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]