SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011698 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011698
Domain Number 1 Region: 64-106
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.46e-16
Family LIM domain 0.0024
Further Details:      
 
Domain Number 2 Region: 107-152
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.22e-16
Family LIM domain 0.00034
Further Details:      
 
Domain Number 3 Region: 1-45
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000178
Family LIM domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011698   Gene: ENSDORG00000012441   Transcript: ENSDORT00000012441
Sequence length 155
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6158:89294:94772:-1 gene:ENSDORG00000012441 transcript:ENSDORT00000012441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESAQPH
RPTTNPNTSKFAQKFGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTL
TEKDGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
Download sequence
Identical sequences ENSDORP00000011698 ENSDORP00000011698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]