SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011773 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011773
Domain Number 1 Region: 25-255
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-70
Family Eukaryotic proteases 0.00000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011773   Gene: ENSDORG00000012521   Transcript: ENSDORT00000012521
Sequence length 259
Comment pep:novel scaffold:dipOrd1:scaffold_44649:2910:7275:-1 gene:ENSDORG00000012521 transcript:ENSDORT00000012521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWFSTLCVILSLGKTGAAPFIQSRVIGGWECERHSQPWQVAVSHHGLAVCGGVLVHPQWV
LTAAHCIKDTSQVWLGRHNLLEDEDSAQRVAVRHSFPHPLYDMSLLEGRDPGSDSDGSHD
LMLLRLSAPANITDAVQVLGLPTEEPSLESCFASGWGSIHPQISLFPKTLQCVDLRLFSN
GICEEVYSEKVTEFMLCAGRLKGGKDTCIGDSGGPLICNGMLQGLTSWGGDPCALPRRRA
YTKLMPYRKWIEDIMIANP
Download sequence
Identical sequences ENSDORP00000011773 ENSDORP00000011773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]