SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011785 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011785
Domain Number 1 Region: 102-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000134
Family EGF-type module 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011785   Gene: ENSDORG00000012536   Transcript: ENSDORT00000012533
Sequence length 206
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_2523:40277:50698:-1 gene:ENSDORG00000012536 transcript:ENSDORT00000012533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLPSVVPKLFLAAMFSALVTGESLERLRRGMAAGTSNPDPPTGSTDQLLPTGGARTRE
VVDLEESALFRVALSSKPQALATPSKEETGKRKKKGKGLGKKRDPCLRKYKDFCIHGECK
YLKELRAPSCICHPGYHGERCHGLSLPVENRLYSYDHTTILAVVAVVLSSVCLLVIVGLL
MFRYHRRGGYDVENEEKVKLGMTNSH
Download sequence
Identical sequences A0A1S3FIC1
XP_012875794.1.60039 ENSDORP00000011785 ENSDORP00000011785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]