SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011799 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000011799
Domain Number - Region: 138-193
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00254
Family Link domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011799   Gene: ENSDORG00000012546   Transcript: ENSDORT00000012547
Sequence length 928
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_638:696:30972:1 gene:ENSDORG00000012546 transcript:ENSDORT00000012547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAADSDEDLVSYGTGLEPLEEGERPKKPIPLQDQTVRDEKGRYKRFHGAFSGGFSAGYF
NTVGSKEGWTPSTFVSSRQNRADKSVLGPEDFMDEEDLSEFGIAPKAIVTTDDFASKTKD
RIQEKARQLVAATAPIPGATLLDDFVTPAKLSVGFELLRKMGWKEGQGVGPRVKRRPRRQ
KPDPGVKIYGCALPPGDSEGSEDEDDDYLPDNVTFAPKDVTPVDFTPKDNVHGLAYKGLD
PHQALFGSSREHFNLFGGGSEGAGHLIGNVEPNKGRKLGISGQAFGVGALEEDDDIYATE
TLSKYDTVLKDECDGLYGWTAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYAP
PELPRDYRPVHYFRPVVAATSENSHLLQVLSDSAGKAVPDPGTHSRHQLNASKRGELLGE
TPVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDVNDKQSAVKMKMFG
KLTRDTFEWHPDKLLCKRFNVPDPYPNSTLVGLPRVKRDKYSVFNFLTLPESSSLPTTPE
PIGKVPEHRASDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXTTKPDVESQAEEEGKRPSMDLFRAIFASSSDEKSSSSEDEQGDSEDNQEGAV
EANLQLPQETHMEETSSTAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKKHKKHKHKSKQKNKKSEKNSSSESSDTSD
SQSDEEGTSDLSPQELLRRLKCLPLRRQ
Download sequence
Identical sequences ENSDORP00000011799 ENSDORP00000011799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]