SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011852 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011852
Domain Number 1 Region: 1561-1674
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-43
Family Noncollagenous (NC1) domain of collagen IV 0.00000311
Further Details:      
 
Domain Number 2 Region: 1455-1560
Classification Level Classification E-value
Superfamily C-type lectin-like 1.13e-42
Family Noncollagenous (NC1) domain of collagen IV 0.00000508
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011852   Gene: ENSDORG00000012601   Transcript: ENSDORT00000012603
Sequence length 1676
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1216:48029:223202:-1 gene:ENSDORG00000012601 transcript:ENSDORT00000012603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPGFWLLLVSLCLSKELAEAGEKSYGKPCEGQDCTWGCTCSPEKGSRGQHGVMGTQGPT
GPKGFTGPPGLSGLKGERGSPGRLGPYGPKGDKKLSVLVLLIYNGHPGQPGPRGPPGLDG
CNGTQGAVGFPGHDGYHGILGPPGLPGRKGSKGEPAPTQGSFVGMEFHFLIECIGPQGPP
GSPGGVGSMGSPGLQXXXXXXXXXSFFPKSERAIVHENLFGDVGLPGPAGPPPSTGELEF
MGFPKGKKGSKGVPGLPGFPGYPGFPDLESIGEKGEKGILGLPGLRSLLCTYTSNLMITF
LLGERGSPGFPGFNGFIGVKGERGSIGLPGPDIFTDINGAVISGYPGDTGVPGVPGLRGD
EGIQGQRGPSGNPGLPALTGIPGAPGPQGFPGLKGDQGNPGHTTIGTAGLPGKIGLPGLP
GAVGLPGPAFKTEILHDTKPGFPGLPGEQGQKGEPGLKGIKGDSGFCSCDGGIHNAGPPG
EPGLPGPQGLIGLPGLKGTRGDPGSGGTRGPAGAPGLFGPPGHAGPKGKKGEPTAHRGSG
LPGEKGDSGHRGIPGITGVPGMDGVPGLRGLPGLRGDDRHGFPGEKGLPGLPGEKGQQGP
PGPPGTGLPGLPGPRGLPGDKGVDGIPGKQGLHGPQGITLPCIIPGSYGPSGVPGAPGFP
GPKGVQGLPGTPGKPGSPGNKGEPGSPGLIQLPELPGFPGSRGEKGLSGFPGLPGKDGLP
GNSGSPGLPGSKGVPGDIFGAENGAPGEPGIQGLPGDKGFPGDSGLPGPNGFHGRPGLLG
PKGERGSPGASGQIGQPGPPGANDLYGIKGKSGHPGSPGLPGTSGHPGKKGLKGEAGQPG
STTKEGVPGIKGLPGSPGLIGVLGNPGLPGVTGLPGLPGQKGEKGSPGPAGFPGIQGLPG
IPGASGVKGAPGSPGKMGTSGRAGSPGEKGDRGDPGPVGVPIPRPPMLNLWFKGDKGSQG
SAGSDGFPGPRGDKGVAGHPGSPGLPGAPGLPSTIKGLSGRPGPPGALGLQGLPGLKGSP
GITGFPGMPGKPGSRGLIGASGFPGTSGLPGSKGDQGQTFDIFGSPGPKGKPGDPGFKGI
KGKDGLIGDKGFPGPKGQDGNDGISGDAGLPGSPGLPGITGMRGDPGLPGSSGHPGSTGL
LGPSGLIGPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXFPGLQGPAGPAGAPGISLPSVTAGRPGDPGPPGLDGEQGRPGL
QGPPGPPGPSSDQGDTGDPGYPGIPGLQGPKGDQGISGFSGLPGNLGLKGVRGEPGFMGT
PGKIGPQGDPGFPGMKGKAGTRGFPGPQGAPGRTPIAEVIQAPPGPLGLPGLEGIPGLTG
DPGLQGPIGLQGPKGLPGIPGKDGPSGLPGPPGILGDPGLPGLQGPPGFEGVPGKQGPFG
RPGIPGPSVQVGYTLVKHSQSEQVPQCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSC
LPRFTTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVGQAQIPQYISRCSVCEAPS
QAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIE
CSGALGTCHYFANKYSFWLTTVEEKQQFREDPVSETLKTGQLHTRVSRCQVCMKSL
Download sequence
Identical sequences ENSDORP00000011852 ENSDORP00000011852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]