SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011855 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011855
Domain Number 1 Region: 493-833
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.37e-111
Family PDEase 0.000000288
Further Details:      
 
Domain Number 2 Region: 237-289,321-458
Classification Level Classification E-value
Superfamily GAF domain-like 1.03e-29
Family GAF domain 0.00076
Further Details:      
 
Domain Number 3 Region: 158-250
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000211
Family GAF domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011855   Gene: ENSDORG00000012607   Transcript: ENSDORT00000012606
Sequence length 860
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4195:72290:141079:-1 gene:ENSDORG00000012607 transcript:ENSDORT00000012606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVTAEEVEKFLDSHIGFAKQYYNLRYRAKVXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDHFCDFVDNLTDYQTKNILAC
PIMNGKDVVAVIMAVNKVDAPHFTKADEEVLLKYLNFLNLIMKVFHLSYLHNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEAP
PYSGPRTPDGREINFYKVIDYILHGKEDIKVIPNPPPDHWALVSGLPSYVAQNGLICNIM
NAPAEDFFEFQKEPLDESGWMIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEMDETLM
ESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPW
DCEEEELAEILQEELPDAEKYEINKFHFSDLPLTELELVKCGIQMYYELRVVEKFHIPQE
ALVRFMYSLSKGYRRITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKTYESEQEWTQYMMLEQTRKEIVMAMMMTACD
LSAITKPWEVQSKVALLVAAEFWEQGDLERTVLQQNPIPMMDRNKADELPKLQVGFIDFV
CTFVYKEFSRFHEEITPMLDGITNNRKEWKALADEYEAKMKTLEEEKQKKQGAQPATSGD
QPSGNPAPGGAPASKSCCVQ
Download sequence
Identical sequences ENSDORP00000011855 ENSDORP00000011855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]