SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011864 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011864
Domain Number 1 Region: 6-95
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-25
Family PDZ domain 0.00033
Further Details:      
 
Domain Number 2 Region: 285-314
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000706
Family LIM domain 0.001
Further Details:      
 
Domain Number 3 Region: 252-284
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000271
Family LIM domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011864   Gene: ENSDORG00000012617   Transcript: ENSDORT00000012617
Sequence length 329
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_484:6422:44509:-1 gene:ENSDORG00000012617 transcript:ENSDORT00000012617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTQQIVLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAAVANLCIGDIITAIDGENTNG
MTHLEAQNKIKGCTDNMTLTVTRSEQKIWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAH
NRSAMPFTASPASGTAPRVITNQYNNPSGLYSSENISNFNNAVESKTAASGGEANGRPVD
HAQASGGLIIDKESEVYKMLQEKQELNEPPKQSTSFLVLQEILESDEKGDPNKPSGFRSV
KAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRERHRHPECYVCSDCGTNLKQKGHFF
VEDQIYCEKHARERVTPPEGYDVVTVFPQ
Download sequence
Identical sequences ENSDORP00000011864 ENSDORP00000011864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]