SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011887 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011887
Domain Number 1 Region: 130-250
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000471
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 544-704
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000143
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 241-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000193
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 4 Region: 8-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000267
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011887   Gene: ENSDORG00000012643   Transcript: ENSDORT00000012641
Sequence length 914
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4384:6950:84588:-1 gene:ENSDORG00000012643 transcript:ENSDORT00000012641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDECENDYYNGGCVHDCINIPGNYRCTCFDGFMLAHDGHNCLXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXTCNYGNGGCQHSCEDTDTGPVCGCHQKYALHADGRTCIETCAVNNGGCDR
TCKDTATGVRCSCPVGFTLQPDGKTCKDINECLVNNGGCDHFCRNTVGSFECGCRKGHKL
LTDERTCQDIDECSFERTCDHICINSPGSFQCLCQSGYVLYGATHCGXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXMGKCLSRALASAQAQLACSKVGGVESCFLSC
PAHTLFVPDAENSYVLSCGVPGPQGKTPPKRNGTISSAGSGCSDAPSAPIKQKARFKIRD
ARCQLRPHSRERAKEAVRQPLLDSCQVTLVTLKCDSSRKRRRGRQSPSKEVSHITAEFEV
EVKPGETSDSCEVDCMRKRAEQSLQAAIKTLRKSISRQQFYVQISGTEYEVAQRPAKALE
GPATCGPGQVLRDGKCVPCGPGTSFSGEPSQCVPCPPGTYQDMEGQLSCTPCPSSDGLGL
AGARNISECGGQCSPGFFSATGFKACQACPMGTYQPEPGRTRCFPCGGGLLTKHAGSTSF
QDCEAKVHCSPGHHYNTTTHRCIRCPVGTYQPEFGQNHCLTCPGNTSTDFDGSTNVTHCK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRSFIK
LLRSKVSRFLRPYK
Download sequence
Identical sequences ENSDORP00000011887 ENSDORP00000011887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]