SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011945 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011945
Domain Number 1 Region: 180-239
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 243-304
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000021
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 120-178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000157
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011945   Gene: ENSDORG00000012702   Transcript: ENSDORT00000012701
Sequence length 492
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3547:22861:101538:-1 gene:ENSDORG00000012702 transcript:ENSDORT00000012701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XCRIPQIEDAEIHNKTYRHGDKLIITCHEGFKIRYPDLYNTVSLCRDDGSWDNLPICQGC
LRPLASSNGYVNISEFQTSFPVGTVIAYRCFPGFKLEGSEYLECLHNLIWSSSPPRCLAL
EAQVCPLPPMVSHGDFICHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSY
QVYCIKSEQTWPSTHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKAHFPTRGPPR
SSSSDPDFVVVDGVPVMLPSYDEAVSGGLSALGPGYLTSVGQGCPLPVDDQSPPAYPGPG
DTDTGPGESETCDSTSGSSELLQSLYSPPMCQGGSCPSSDNPDTIGNTAGEVASTSPGID
IADEIPLMEEDP
Download sequence
Identical sequences ENSDORP00000011945 ENSDORP00000011945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]