SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012062 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012062
Domain Number 1 Region: 318-538
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.36e-49
Family Reprolysin-like 0.0079
Further Details:      
 
Domain Number 2 Region: 1083-1139
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000131
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 912-972
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000017
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 4 Region: 976-1032
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000249
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 5 Region: 632-681
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000366
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012062
Domain Number - Region: 1035-1078
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00366
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012062   Gene: ENSDORG00000012822   Transcript: ENSDORT00000012825
Sequence length 1203
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3696:25958:224520:1 gene:ENSDORG00000012822 transcript:ENSDORT00000012825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRLTHWCCCCLLYQLGLPWNGVASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXGRFLAPRFAEEQWPSSGRAAAAPPPPATPSASCFYSGVVLRNPGSLASFSTCGGGLM
GVIQLNEDLIFIEPLNNTMAITGHPHRLYRQKKSVEERVTEKSDHHNHYCGIISDKGRPR
SKKLAESGRWKQSSYKSSQEYNIETVVVADPAMVSYHGADAARRFILTILNMVFNLFQHK
SLGVQVNLRVIKLILLHETPADLYIGHHGEKMLESFCKWQHEEFGKKNDIHSEMSTHWRE
DLTSIDAAILITRKDFCVHKDEPCDTVGIAYLNGICSEKRKCIIAEDNGLNLAFTIAHEM
GHNMGINHDNDHPSCAEGLHIMSGEWIKGQNLGDVSWSGCSKQDLERFLRSKASSCLLQT
NPQSVNSVMVPSKLLGTAYTADEQCQILFGPSASFCEEKQNVICMGLWCRVEGEKECRSK
LDPPMDGTDCLPGKWCKAGECTSRTPAPEHRAGEWSMWSSCSRTCSSGTSSRERRCPGXX
XEARDCNGPRKQYRVCENPPCPAGLPGFRDWQCQTYNFKTSHPKQVLPWQAVMDEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXYVEVLVIPAGARSIKVVEEKPAHSYLVLRDTGKRSINSDWK
IEHSGAFNLAGTTIHYIRRGLWEKISARGPTTTPLHLLVLLFQDQNYGLHYEYTIPSEPI
PDNQSSRASEPLFLWTHTGWEDCDVTCGGGERKTTVSCTKVMSKNISIVDNKKCKYLTKP
DPQIRKCNEQPCQTRWMMTEWTTCSRTCGKGMQNRQVACTQQLSNGTLIRAQERDCVGPK
PASAQRCEGQDCMTVWEAGVWSEXXXXCGKGVRHRTVRCTNPRKKCVLSTRPREAEDCED
YSKCYVWQMGDWSKCSITCGKGMQSRVIQCMHKITGRHGNECFSSEKPAAYRPCHLQPCN
EKINVNTITSPRLAALTFKCLGDQWPVYCRVIREKNLCQDMRWYQRCCDMCRDFYAQKLQ
QKS
Download sequence
Identical sequences ENSDORP00000012062 ENSDORP00000012062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]