SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012080 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012080
Domain Number 1 Region: 286-452,493-627
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.54e-58
Family Tandem AAA-ATPase domain 0.00048
Further Details:      
 
Domain Number 2 Region: 58-250
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-38
Family SPRY domain 0.0026
Further Details:      
 
Domain Number 3 Region: 3-68
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000029
Family Tandem AAA-ATPase domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012080   Gene: ENSDORG00000012847   Transcript: ENSDORT00000012847
Sequence length 740
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3990:434165:465702:1 gene:ENSDORG00000012847 transcript:ENSDORT00000012847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPV
IQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWH
GCRATKGLMKGKHYYEVSCHDQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFD
NYGEEFTMHDTIGCYLDIDKGQVKFSKNGKDLGLAFEVPAHMKNQALFPACVLKNAELKF
NFGEEEFKFPPKDGFVALSKAPDSYVVKSQHTGNAQVTQTKFLPNAPKALIVEPSRELAE
QTLNNVKQFKKYIDNPKLRELLIIGGVAARDQLSVLDNGVDIVVGTPGRLDDLVSTGKLN
LSQVRFLVLDEADGLLSQGYSDFINRMHSQIPQITSDGKRLQVIVCSATLHSFDVKKLSE
KIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKNDRLWERLGKNHIRTDDVHAKDNTRPGAN
SPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFMQQGGGPDKKGHQF
SCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
HRIGRVGRAERMGLAISLVATEKEKVWYHVCSNRGKGCYNTRLKEDGGCTIWYNEMQLLS
EIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGNYKGHVDILAPTVQELAALEK
EAQTSFLHLGYLPNQLFRTF
Download sequence
Identical sequences A0A1S3EZ21
ENSDORP00000012080 ENSDORP00000012080 XP_012869145.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]