SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012091 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012091
Domain Number 1 Region: 316-413
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.81e-34
Family Eukaryotic proteases 0.0034
Further Details:      
 
Domain Number 2 Region: 153-228
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.28e-20
Family Eukaryotic proteases 0.0047
Further Details:      
 
Domain Number 3 Region: 37-157
Classification Level Classification E-value
Superfamily SEA domain 0.000000183
Family SEA domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012091   Gene: ENSDORG00000012858   Transcript: ENSDORT00000012858
Sequence length 414
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6164:16809:53807:-1 gene:ENSDORG00000012858 transcript:ENSDORT00000012858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSGFGPKSRALKPWLVVLLIVLALILMVLTVVVLAPFLGSGQRMEYYHGIIEVSHPQDNS
HTEKKNSYQLKELQEMNEHLVSVDKIFIVSTLNKHYIKNQVVRLIPEDEVKADTVTAYQI
PSTVHKTKREKKIHHILNQKTRKTRALPINVSSVQANMYSSAGKLSVQASCGKRVAPLIV
NRIMSGELAAKGAWPWQASLQRGNIHQCGATLISNMWLVTAAHCFKXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXESQNNLREARVKIISNAVCKQPHVYGNDIKFGMFCAGFLEGNYDAC
RGDSGGPLVVRDPNGTWYLMGIVSWGDNCGQKNKPGVYTQVTYYRRWIASRTGL
Download sequence
Identical sequences ENSDORP00000012091 ENSDORP00000012091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]