SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012100 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012100
Domain Number 1 Region: 14-132
Classification Level Classification E-value
Superfamily POZ domain 7.22e-39
Family BTB/POZ domain 0.00098
Further Details:      
 
Domain Number 2 Region: 289-394
Classification Level Classification E-value
Superfamily Kelch motif 2.48e-26
Family Kelch motif 0.00056
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012100
Domain Number - Region: 248-294
Classification Level Classification E-value
Superfamily PUG domain-like 0.0942
Family PUG domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012100   Gene: ENSDORG00000012870   Transcript: ENSDORT00000012869
Sequence length 584
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6407:4400:17348:-1 gene:ENSDORG00000012870 transcript:ENSDORT00000012869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANEGCLKAGENPFSSDKHAQFILAQINKMRNEQHFCDVQLQVGKETFCVHRLVLAASSP
YFAALFSGGMKESSKDVVQILGIEAGIFQLLLDFIYTGLVNIAANNVQELIVAADMLQLT
EVVNLCCDFLKGQIDPLNCIGIFQFSEQIACHDLLEFTENYIHVHFLEVHSGEEFLALTK
DQLIKILRSEELSIEDEYQVFLAAMQWILKDLGKRRKHVVEVLDPIRFPLLPPQRLIKYI
EGVSDFNLRVALQTLLKEYCEVCKSPKENKFCSFLQTSKVRPRKKARKYLYAVGGYTRLQ
GGRWSDSRALSCVERFDTFSQYWTTVSSLHQARCGLGVAVLGGMVYAIGGEKDSMIFDCT
ECYDPVTKQWTTVASMNQPRCGLGVCVSYGAIYALXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSRCEGGVAVL
Download sequence
Identical sequences ENSDORP00000012100 ENSDORP00000012100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]