SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012106 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012106
Domain Number 1 Region: 322-490,531-603
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.45e-26
Family Prokaryotic proteases 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012106   Gene: ENSDORG00000012875   Transcript: ENSDORT00000012875
Sequence length 611
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_34810:8345:11722:1 gene:ENSDORG00000012875 transcript:ENSDORT00000012875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKKRKSQKITFDARNNMKIKHYFPQKPKEEQNSPSTSQMKVESRKRPSDITNTIEQTS
HLPKSKPQDLTATPKKKIEITFDVNIRKHKNMKYTLIHDEKESLYKGLVTLDAVKTEIDA
RPGQEMLVCGTKGIEGYLNLGMPLHCFPEKNHVEITFFKSSYEQKEYKQMSGRYDHASTE
CVKFYVHAIEEGKRIVRCRKLHKEGSKLCVFGFKGETIKDTLCKDGRFCALIEKESWRLI
GDLDSIIESTQPVDELEGQLFQVEVEKGKAESAAPAPNLEPEEKVLKEYIVKEYPSLRSE
SKKIREYIKEKAEQRKKGKKTSLFTLHRRNFGKLTKNATLVKVHKFLSQLGDSVGFLLWD
NNGNMGCATCFVFSGPFILTCRHVINDIVGKGIEPSQWADIIGQCVKVIFNYEEVPVKEE
NCFFLEPWFQISDGTLDYAVLKLKADGQPVPLGLRDKIAPLPLNGLMYIIGHPQGESKRT
DGCAVIPQSEREQKYKENIQAGEAVGCNFPPHFVYMHTQNSFQKIAHNPDVLTYDTLFIG
ASGSPVFDSQGSLVAMHTAGITCEYQHGILNIEFGSSMESILSDMKQKDEAWYNEVCVQP
QDVEMLSQDDC
Download sequence
Identical sequences ENSDORP00000012106 ENSDORP00000012106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]