SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012107 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012107
Domain Number 1 Region: 316-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-35
Family SPRY domain 0.0012
Further Details:      
 
Domain Number 2 Region: 173-232
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000037
Family Fibronectin type III 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012107
Domain Number - Region: 8-114
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00366
Family Formin homology 2 domain (FH2 domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012107   Gene: ENSDORG00000012878   Transcript: ENSDORT00000012877
Sequence length 498
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1503:20085:79599:1 gene:ENSDORG00000012878 transcript:ENSDORT00000012877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQKEALQRIISTLANKNDEIQNFIDTLNHTLKGVQENSSNILSELDEEFDSLYSILDE
VKESMINSIKQEQARKSXXXXNQLIQCNTALENSEELLEYASRSLDIKEPEAFSKAARQI
KDRVTMASAFRLSLKPRVSDNMTHLMVDFSQERQMLQTLKFLPVPKSPEIDPVDCLVADN
AVTVVWRMPDEDNKIDHFILEYRKTNFDGLPRVKDEQCWELVDHIKGTEYTLSXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXLNFSLDNSSSHLNLKVEDTCVEWDPTGGKGQES
KIKGKENKGRSGTPSPKRASIGSRPPSVRGSRDRFTGESYTVLGDTAIESGQHYWEVKAQ
KDCKSYSVGVAYKTLGKFDQLGKTNTSWCIHVNNWLQNTFAAKHNNKVKALDVSVPEKIG
VFCDFDGGQLSFYDANSKQLLYSFKTKFTQPVLPGFMVWCGGLSLSTGMQVPSAVRTLQK
SENGMTGSASSLNNATTQ
Download sequence
Identical sequences ENSDORP00000012107 ENSDORP00000012107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]