SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012125 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012125
Domain Number 1 Region: 474-633
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.1e-58
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000012
Further Details:      
 
Domain Number 2 Region: 54-223
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6e-49
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000166
Further Details:      
 
Domain Number 3 Region: 279-373
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.92e-23
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012125   Gene: ENSDORG00000012895   Transcript: ENSDORT00000012895
Sequence length 636
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2777:917:962449:1 gene:ENSDORG00000012895 transcript:ENSDORT00000012895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFGKAELISRNTKKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDK
LEEEINRRMADDNKLFREEFNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHSRVHLT
PVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKER
KECKCAQYWPDQGCWTYGNIRVSVEDVTVLVDYTVRKFCIQQXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGVGRTGTFVVIDAMLDMMHTE
RKVDVYGFVSRIRAQRCQMVQTDMQYVFIYQALLEHYLYGDTELEVTSLETHLQKIYNKI
PGTSNNGLEEEFKLTSIKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKCAQY
WPSDGLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDG
KGMISIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKS
LRLQRPHMVQTLEQYEFCYKVVQEYIDAFSDYANFK
Download sequence
Identical sequences ENSDORP00000012125 ENSDORP00000012125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]