SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012134 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012134
Domain Number 1 Region: 46-183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-37
Family Galectin (animal S-lectin) 0.0002
Further Details:      
 
Domain Number 2 Region: 212-337
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.49e-16
Family Galectin (animal S-lectin) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012134   Gene: ENSDORG00000012907   Transcript: ENSDORT00000012904
Sequence length 337
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_21702:427:13228:-1 gene:ENSDORG00000012907 transcript:ENSDORT00000012904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGSSARRAPGIEIRSPGRSCPTLMAPGGALDPIPDSFILQPPIFHPVIPYVTTIFGGLYA
GKMVMLQGVVPLHARRFQVDFQCGCSLSPRPDIAIHFNPRFHTTTPHAICNSLHSGQWQA
EVRWPGLDLRRGASFIILFLFENEEMKVSINGKHFLHFHYRLPLCRVNTLGIYGDILVKA
VGFLNINPFAEGSKEYPAGHPFLLYSAQLELPCSRALSRGLWPGQVIIVRGLVTQEPKDF
TLSLRDEAARVPVTLRASFADQTLAWISHWGRKKLIPAPFLFYPQRFFEVLLLCQEGGLK
LALNGQGLGATSLDQQVLEQLRELRISGSVQLYCVHI
Download sequence
Identical sequences ENSDORP00000012134 ENSDORP00000012134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]